PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572595.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 27903.4 Da    PI: 9.8642
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572595.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.31.5e-313281150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  XP_012572595.1 32 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 81
                    79***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-412483IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.6832484IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-332596IPR002100Transcription factor, MADS-box
CDDcd002655.48E-452599No hitNo description
PRINTSPR004044.5E-332646IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002680IPR002100Transcription factor, MADS-box
PfamPF003199.1E-273380IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-334661IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-336182IPR002100Transcription factor, MADS-box
PfamPF014867.3E-18107193IPR002487Transcription factor, K-box
PROSITE profilePS5129711.214110216IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MMDESLQGMD FQNQSMSDSP QRKIGRGKIE IKRIENTTNR QVTFCKRRNG LLKKAYELSV  60
LCDAEVALIV FSSRGRLYEY ANNSVKATIE RYKKACSDSS GTGSASEANA QFYQQEADKL  120
RAQISNLQNN NRLKCRQMMG ESLGSMTAKE LKNLEGKLEK GISRIRSKKE IDLHNNNQLL  180
RAKIAESERN HHNMSVLPGG TSYESMQSQH QQQQQQYDSR GYFQVTGLQP SSQYARQDQM  240
SLQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-202492169Myocyte-specific enhancer factor 2B
1tqe_R1e-202492169Myocyte-specific enhancer factor 2B
1tqe_Q1e-202492169Myocyte-specific enhancer factor 2B
1tqe_P1e-202492169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1598041e-166KF159804.1 Medicago truncatula cultivar Jemalong A17 MADS-box transcription factor AGAMOUSa (AGa) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572595.10.0PREDICTED: floral homeotic protein AGAMOUS isoform X6
SwissprotQ435851e-117AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLT2D2Y21e-147T2D2Y2_PEA; MADS-box transcription factor 12
STRINGGLYMA13G29510.11e-135(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.14e-91MIKC_MADS family protein